For research use only. Not for therapeutic Use.
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1].
| Catalog Number | I044232 |
| Molecular Formula | C164H238N40O55 |
| Purity | ≥95% |
| Reference | [1]. Robson B, et, al. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles’ heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med. 2020 Jun;121:103749. |
