STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

For research use only. Not for therapeutic Use.

  • CAT Number: I044232
  • Molecular Formula: C164H238N40O55
  • Molecular Weight: 3649.88
  • Purity: ≥95%
Inquiry Now

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1].


Molecular Formula C164H238N40O55
Purity ≥95%
Reference

[1]. Robson B, et, al. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles’ heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med. 2020 Jun;121:103749.
 [Content Brief]

Request a Quote