TEM-type beta-lactamases are the most common in enterobacteria, responsible for hydrolyzing the beta-lactam ring in susceptible antibiotics, leading to resistance against penicillins and cephalosporins. Variants like TEM-3 and TEM-4 can hydrolyze cefotaxime and ceftazidime, while TEM-5 is effective against ceftazidime. TEM-6 targets both ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7, and TEM-24/CAZ-6 exhibit strong activity against ceftazidime. IRT-4, another variant, shows resistance to beta-lactamase inhibitors, further complicating treatment options for infections caused by resistant enterobacteria. These enzymes play a significant role in antimicrobial resistance.
Product Name | Recombinant Beta-lactamase TEM (bla) |
Accession | P62593 |
Purity | >85% (SDS-PAGE) |
Host Species | Escherichia coli |
Gene | bla; |
Source | E.coli;In Vivo Biotinylation in E.coli;Yeast;Baculovirus;Mammalian cell |
Protein Expression Range | 24-286aa |
Tag | Tag type will be determined during the manufacturing process. |
Molecular Mass | 30.9 kDa |
Form | Lyophilized powder |
Buffer | Tris/PBS-based buffer, 6% Trehalose. |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Research Area | Others |
Alternative Names | bla;; blaT-3;; blaT-4;; blaT-5;; blaT-6Beta-lactamase TEM; EC 3.5.2.6; IRT-4; Penicillinase; TEM-1; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2 |
Target Protein Sequence | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
Protein Length | Full Length of Mature Protein |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |