Recombinant Beta-lactamase TEM (bla)

  • Purity: >85% (SDS-PAGE)
  • Host Species: Escherichia coli
  • Accession: P62593
  • Gene: bla;
  • CAT.NO: B000195
  • Expression Systems:

    E.coli

    In Vivo Biotinylation in E.coli

    Yeast

    Baculovirus

    Mammalian cell

Inquiry Now

TEM-type beta-lactamases are the most common in enterobacteria, responsible for hydrolyzing the beta-lactam ring in susceptible antibiotics, leading to resistance against penicillins and cephalosporins. Variants like TEM-3 and TEM-4 can hydrolyze cefotaxime and ceftazidime, while TEM-5 is effective against ceftazidime. TEM-6 targets both ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7, and TEM-24/CAZ-6 exhibit strong activity against ceftazidime. IRT-4, another variant, shows resistance to beta-lactamase inhibitors, further complicating treatment options for infections caused by resistant enterobacteria. These enzymes play a significant role in antimicrobial resistance.

Product Name Recombinant Beta-lactamase TEM (bla)
Accession P62593
Purity >85% (SDS-PAGE)
Host Species Escherichia coli
Gene bla;
Source E.coli;In Vivo Biotinylation in E.coli;Yeast;Baculovirus;Mammalian cell
Protein Expression Range 24-286aa
Tag

Tag type will be determined during the manufacturing process.

Molecular Mass 30.9 kDa
Form Lyophilized powder
Buffer

Tris/PBS-based buffer, 6% Trehalose.

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Research Area

Others

Alternative Names

bla;; blaT-3;; blaT-4;; blaT-5;; blaT-6Beta-lactamase TEM; EC 3.5.2.6; IRT-4; Penicillinase; TEM-1; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2

Target Protein Sequence HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Protein Length Full Length of Mature Protein
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote