Recombinant Human Adenosine receptor A2a (ADORA2A), partial,Baculovirus

• Purity: >85% (SDS-PAGE)
• Host Species: Homo sapiens (Human)
• Accession: P29274
• Gene: ADORA2A
• CAT.NO: B000177
• Expression Systems: Baculovirus
• Product Name: Recombinant Human Adenosine receptor A2a (ADORA2A), partial,Baculovirus
• Protein Expression Range: 291-412
• Tag: N-terminal His-tagged and C-terminal Myc-tagged N-terminal His-tagged Tag-Free
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Alternative Names: A2AAR; A2aR; AA2AR_HUMAN; ADENO; Adenosine A2 receptor; Adenosine A2a receptor; Adenosine receptor A2a; Adenosine receptor subtype A2a; ADORA 2; ADORA2; ADORA2A; hA2aR; RDC 8; RDC8
• Target Protein Sequence: RIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
• Protein Length: partial, Cytoplasmic domain
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.