Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active)

• Purity: Greater than 95% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: P27037
• Gene: ACVR2A
• CAT.NO: B000239
• Expression Systems: Mammalian cell
• Product Name: Recombinant Human/Cynomolgus Activin receptor type-2A (ACVR2A), partial (Active)
• Protein Expression Range: 20-135aa
• Tag: C-terminal 10xHis-tagged
• Molecular Mass: 14.8kDa
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.848-4.375 ng/mL.
• Target Protein Sequence: AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
• Protein Length: Partial
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature; and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized; form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.