Recombinant Human Cytochrome P450 11B1, mitochondrial (CYP11B1)

• Purity: Greater than 85% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: P15538
• Gene: CYP11B1
• CAT.NO: B000261
• Expression Systems: E.coli In Vivo Biotinylation in E.coli Yeast Baculovirus Mammalian cell
• Product Name: Recombinant Human Cytochrome P450 11B1, mitochondrial (CYP11B1)
• Source: E.coli;In Vivo Biotinylation in E.coli;Yeast;Baculovirus;Mammalian cell
• Protein Expression Range: 25-503aa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Molecular Mass: 74.9 kDa
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Research Area: Cancer
• Alternative Names: CYP11B1; S11BHCytochrome P450 11B1; mitochondrial; CYPXIB1; Cytochrome P-450c11; Cytochrome P450C11; Steroid 11-beta-hydroxylase; CYP11B1; EC 1.14.15.4
• Target Protein Sequence: GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
• Protein Length: Full Length of Mature Protein
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

This cytochrome P450 monooxygenase is crucial in the biosynthesis of adrenal corticosteroids. It catalyzes various reactions essential for detoxification, defense, and the formation of endogenous compounds such as steroid hormones. Specifically, it acts as a steroid 11beta, 18-, and 19-hydroxylase, with the highest regioselectivity at the 11beta position, followed by 18, and then 19. It hydroxylates 11-deoxycortisol and 11-deoxycorticosterone at the 11beta position, producing cortisol and corticosterone, but it cannot produce aldosterone due to a lack of 18-oxidation activity. Mechanistically, it uses molecular oxygen and NADPH to carry out hydroxylation, with involvement in androgen metabolism.