Recombinant Human Gonadotropin-releasing hormone receptor (GNRHR)

• Host Species: Homo sapiens (Human)
• Accession: P30968
• CAT.NO: B000235
• Expression Systems: In vitro E.coli expression system
• Product Name: Recombinant Human Gonadotropin-releasing hormone receptor (GNRHR)
• Protein Expression Range: 1-328
• Tag: Tag type will be determined during the manufacturing process.
• Form: Lyophilized powder
• Buffer: Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Alternative Names: GNRHR; GRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
• Target Protein Sequence: MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL
• Protein Length: Full length protein
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

The gonadotropin-releasing hormone (GnRH) receptor mediates the effects of GnRH by stimulating the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH). It functions through association with G-proteins, which activate a phosphatidylinositol-calcium second messenger system, triggering downstream signaling pathways. This receptor is essential for regulating reproductive functions, including the control of ovulation and spermatogenesis. Isoform 2 of the GnRH receptor may act as an inhibitor of GnRH-R signaling, potentially modulating the receptor’s activity and influencing the regulation of gonadotropin secretion in various physiological contexts.