Product Name | Recombinant Human Gonadotropin-releasing hormone receptor (GNRHR) |
Accession | P30968 |
Host Species | Homo sapiens (Human) |
Source | In vitro E.coli expression system |
Protein Expression Range | 1-328 |
Tag | Tag type will be determined during the manufacturing process. |
Form | Lyophilized powder |
Buffer | Tris/PBS-based buffer, 6% Trehalose. |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Alternative Names | GNRHR; GRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R |
Target Protein Sequence | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL |
Protein Length | Full length protein |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |