The H3 subclass of histamine receptors plays a crucial role in mediating histamine signaling in the central and peripheral nervous systems. These receptors function by inhibiting adenylate cyclase, and they exhibit high constitutive activity, meaning they show spontaneous activity even in the absence of an agonist. Interestingly, stimulation of the H3 receptor isoform 3 does not alter adenylate cyclase activity or trigger intracellular calcium mobilization, suggesting that its signaling mechanism may differ from other histamine receptor subtypes. This distinctive behavior highlights the unique role of H3 receptors in cellular communication and neural regulation.
Product Name | Recombinant Human Histamine H3 receptor (HRH3) |
Accession | Q9Y5N1 |
Host Species | Homo sapiens (Human) |
Source | In vitro E.coli expression system |
Protein Expression Range | 1-445 |
Tag | Tag type will be determined during the manufacturing process. |
Form | Lyophilized powder |
Buffer | Tris/PBS-based buffer, 6% Trehalose. |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Alternative Names | HRH3; GPCR97; Histamine H3 receptor; H3R; HH3R; G-protein coupled receptor 97 |
Target Protein Sequence | MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK |
Protein Length | full length protein |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |