Integrin alpha-V/beta-3 (ITGAV:ITGB3) serves as a receptor for several molecules, including cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin, and von Willebrand factor. Similarly, integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) interacts with fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin, and vitronectin. Both integrins alpha-IIb/beta-3 and alpha-V/beta-3 bind the R-G-D sequence present in various ligands. Additionally, integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in the fibrinogen gamma chain, highlighting its role in cellular interactions and signaling.
Product Name | Recombinant Human Integrin beta-3 (ITGB3), partial |
Accession | P05106 |
Purity | >85% (SDS-PAGE) |
Host Species | Homo sapiens (Human) |
Gene | ITGB3 |
Source | E.coli;In Vivo Biotinylation in E.coli;Yeast;Baculovirus;Mammalian cell |
Protein Expression Range | 385-490 |
Tag | Tag type will be determined during the manufacturing process. |
Form | Lyophilized powder |
Buffer | Tris/PBS-based buffer, 6% Trehalose. |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Alternative Names | ITGB3; GP3A; Integrin beta-3; Platelet membrane glycoprotein IIIa; GPIIIa; CD antigen CD61 |
Target Protein Sequence | VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP |
Protein Length | Extracellular domain |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |