Recombinant Human Integrin beta-3 (ITGB3), partial

  • Purity: >85% (SDS-PAGE)
  • Host Species: Homo sapiens (Human)
  • Accession: P05106
  • Gene: ITGB3
  • CAT.NO: B000166
  • Expression Systems:

    E.coli

    In Vivo Biotinylation in E.coli

    Yeast

    Baculovirus

    Mammalian cell

Inquiry Now
Product Name Recombinant Human Integrin beta-3 (ITGB3), partial
Accession P05106
Purity >85% (SDS-PAGE)
Host Species Homo sapiens (Human)
Gene ITGB3
Source E.coli;In Vivo Biotinylation in E.coli;Yeast;Baculovirus;Mammalian cell
Protein Expression Range 385-490
Tag Tag type will be determined during the manufacturing process.
Form Lyophilized powder
Buffer

Tris/PBS-based buffer, 6% Trehalose.

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Alternative Names ITGB3; GP3A; Integrin beta-3; Platelet membrane glycoprotein IIIa; GPIIIa; CD antigen CD61
Target Protein Sequence VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Protein Length Extracellular domain
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote