Home
>
Recombinant Proteins
>
Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) , partial
Product Name | Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) , partial |
Accession | Q03431 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Host Species | Homo sapiens (Human) |
Gene | PTH1R |
Source | Mammalian cell |
Protein Expression Range | 27-188aa |
Tag | C-terminal 10xHis-tagged |
Molecular Mass | 20.3 kDa |
Form | Liquid or Lyophilized powder |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Target Protein Sequence | DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG |
Protein Length | Partial |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |