Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial

• Purity: Greater than 90% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: P42336
• Gene: PIK3CA
• CAT.NO: B000160
• Expression Systems: E.coli
• Product Name: Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial
• Protein Expression Range: 797-1068aa
• Tag: N-terminal 6xHis-tagged
• Molecular Mass: 33.9 kDa
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Research Area: Cancer
• Alternative Names: PI3-kinase subunit alpha;PI3K-alpha;PI3Kalpha;PtdIns-3-kinase subunit alpha;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;PtdIns-3-kinase subunit p110-alpha;p110alpha;Phosphoinositide 3-kinase alpha;Phosphoinositide-3-kinase catalytic alpha polypeptide;Serine/threonine protein kinase PIK3CA
• Target Protein Sequence: NEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
• Protein Length: Partial
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its derivatives at the 3-position of the inositol ring, generating 3-phosphoinositides. Using ATP and PtdIns(4,5)P2, PI3K produces phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 recruits PH domain-containing proteins like AKT1 and PDPK1 to the membrane, activating signaling pathways that regulate cell growth, survival, motility, and morphology. PI3K is crucial for endothelial cell migration, vascular development, and lymphatic vasculature formation. It participates in signaling via receptor tyrosine kinases (EGF, insulin, IGF1, VEGFA) and regulates invadopodia formation and cardiomyogenesis, also exhibiting serine-protein kinase activity.