CONTACT US
Home > Recombinant Proteins > Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial
Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial

Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial

  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Host Species: Homo sapiens (Human)
  • Accession: P42336
  • Gene: PIK3CA
  • CAT.NO: B000160
  • Expression Systems:

    E.coli

Inquiry Now
Product Name Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial
Accession P42336
Purity Greater than 90% as determined by SDS-PAGE.
Host Species Homo sapiens (Human)
Gene PIK3CA
Source E.coli
Protein Expression Range 797-1068aa
Tag N-terminal 6xHis-tagged
Molecular Mass 33.9 kDa
Form Liquid or Lyophilized powder
Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Research Area Cancer
Alternative Names PI3-kinase subunit alpha;PI3K-alpha;PI3Kalpha;PtdIns-3-kinase subunit alpha;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;PtdIns-3-kinase subunit p110-alpha;p110alpha;Phosphoinositide 3-kinase alpha;Phosphoinositide-3-kinase catalytic alpha polypeptide;Serine/threonine protein kinase PIK3CA
Target Protein Sequence NEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Protein Length Partial
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote