Recombinant Human Tissue factor pathway inhibitor (TFPI), partial (Active)

• Purity: Greater than 95% as determined by SDS-PAGE.
• Host Species: Homo sapiens (Human)
• Accession: P10646
• Gene: TFPI
• CAT.NO: B000224
• Expression Systems: Mammalian cell
• Product Name: Recombinant Human Tissue factor pathway inhibitor (TFPI), partial (Active)
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Protein Expression Range: 29-282aa
• Tag: C-terminal 10xHis-tagged
• Molecular Mass: 31.9 kDa
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Storage: 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
• Bioactivity: Active
• Target Protein Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
• Protein Length: Partial