Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

• Purity: Greater than 90% as determined by SDS-PAGE.Greater than 95% as determined by SEC-HPLC.
• Host Species: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
• Accession: P0DTD1
• Gene: nsp9
• CAT.NO: B000142
• Expression Systems: Mammalian cell
• Product Name: Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
• Protein Expression Range: 1-113aa
• Tag: C-terminal hFC-Flag-tagged
• Molecular Mass: 44.5 kDa
• Form: Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Alternative Names: Non-structural protein 9
• Target Protein Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Protein Length: Full Length
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.