Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

  • Purity: Greater than 90% as determined by SDS-PAGE.Greater than 95% as determined by SEC-HPLC.
  • Host Species: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
  • Accession: P0DTD1
  • Gene: nsp9
  • CAT.NO: B000142
  • Expression Systems:

    Mammalian cell

Inquiry Now

This multifunctional protein plays a key role in the transcription and replication of viral RNAs. It includes proteinases responsible for cleaving the viral polyprotein. The protein also functions as a host translation inhibitor (nsp1), blocking host protein synthesis by interacting with the open head conformation of the 40S ribosomal subunit. Its C-terminal region binds to and obstructs the ribosomal mRNA entry tunnel, effectively preventing translation. Additionally, this protein interferes with the antiviral response triggered by innate immunity or interferons, suppressing the host’s ability to mount an effective defense against the viral infection.

Product Name Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
Accession P0DTD1
Purity Greater than 90% as determined by SDS-PAGE.Greater than 95% as determined by SEC-HPLC.
Host Species Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Gene nsp9
Source Mammalian cell
Protein Expression Range 1-113aa
Tag

C-terminal hFC-Flag-tagged

Molecular Mass 44.5 kDa
Form Lyophilized powder
Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Storage

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Alternative Names

Non-structural protein 9

Target Protein Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Protein Length Full Length
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Request a Quote